PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07026.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 576aa    MW: 64503.1 Da    PI: 6.4644
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07026.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.87.1e-1302065751373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+ ++++d e  ++ + + + ++s +g+p+qRl ay++e++ ar   s++++y+al+++e +   s+e l+++++++e++P+lkf++++aN 
  PK07026.2 206 LKNLLIACAKSLAENDIETFDKQIGKARAIVSISGEPIQRLGAYMVEGMVARKEASGTNIYRALRCREPE---SKELLSYMQILYEICPYLKFGYMAANG 302
                5789*****************************************************************9...9************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                aI ea  +e+r+Hi+Df+i qG+QW++LlqaLa+Rp+gpp++RiTg+++p ++  + + le++g+rL  + + +++p+efn+ v     d++ e+L+++p
  PK07026.2 303 AIAEACRNEDRIHIVDFQIAQGTQWLTLLQALAARPDGPPHVRITGIDDPVNHyaRGDGLEAVGKRLVAISQDFKIPVEFNA-VPVFAPDVTREMLDIRP 401
                ***************************************************99999**************************.688899*********** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                gEalaVn+ lqlh+++desv+++++rd +L++vksl Pkvv++veqe+++n+++F++rf+ea+++y a+f+s++++lpr+s+ ri+vE+++l+r+ivnvv
  PK07026.2 402 GEALAVNFPLQLHHTPDESVDVTNPRDGLLRMVKSLYPKVVTLVEQESNTNTTPFFHRFVEAMDFYLAMFESIDVTLPRDSKYRISVEQHCLARDIVNVV 501
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                aceg+er+erhe l+kW++rl++aGFk++pls+++++ +++llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  PK07026.2 502 ACEGRERVERHELLGKWKSRLTMAGFKQYPLSSYVNSVIRSLLRCYS-EHYTLAEKDGAMLLGWKDRNLISASAW 575
                *******************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.767180557IPR005202Transcription factor GRAS
PfamPF035142.5E-127206575IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MDSHQLFGIS VTGAALPYTT SHPTTVPSLP NRLLGSLKFD IGNSPSSPFS TNFDSDNSLT  60
TLSDSQEQYS STENNLSGVS TPPCNSPLDT NSYCLYPCGK SLLQNANSSQ NFKHALLELE  120
TALMGPDDDV DEHRLTRRKP SHVEGPSEQS WKAERPRGQQ PGLTQRQTFL ASRPRQPVEV  180
ARTEKRHKLM EEDSLHQQGL PSLDNLKNLL IACAKSLAEN DIETFDKQIG KARAIVSISG  240
EPIQRLGAYM VEGMVARKEA SGTNIYRALR CREPESKELL SYMQILYEIC PYLKFGYMAA  300
NGAIAEACRN EDRIHIVDFQ IAQGTQWLTL LQALAARPDG PPHVRITGID DPVNHYARGD  360
GLEAVGKRLV AISQDFKIPV EFNAVPVFAP DVTREMLDIR PGEALAVNFP LQLHHTPDES  420
VDVTNPRDGL LRMVKSLYPK VVTLVEQESN TNTTPFFHRF VEAMDFYLAM FESIDVTLPR  480
DSKYRISVEQ HCLARDIVNV VACEGRERVE RHELLGKWKS RLTMAGFKQY PLSSYVNSVI  540
RSLLRCYSEH YTLAEKDGAM LLGWKDRNLI SASAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-612105768375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244327.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLW9RCL60.0W9RCL6_9R
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-164GRAS family protein